Recombinant Human C-C Motif Chemokine 11/CCL11/Eotaxin #abs04166

Recombinant Human C-C Motif Chemokine 11/CCL11/Eotaxin #abs04166

Please note that the price provided serves as a general reference only. For more detailed pricing information, we advise you to get in touch with our seller Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.

Description

Catalog-specification

Delivery time

USD price

abs04166-10ug

1-2 Weeks

146

abs04166-50ug

1-2 Weeks

436

abs04166-500ug

1-2 Weeks

2353

abs04166-1mg

1-2 Weeks

3201

Please note that the price provided serves as a general reference only. For more detailed pricing information, we advise you to get in touch with our seller Vecent.


Overview

Description

Our E.coli expression system produces Recombinant Human C-C Motif Chemokine 11, with the target gene being expressed as Gly24-Pro97.

Other names

Eotaxin, also known as C-C Motif Chemokine 11 or Eosinophil Chemotactic Protein, is a protein that belongs to the small-inducible cytokine A11 family. Its official symbol is CCL11 and it is also referred to as SCYA11. This chemokine is involved in recruiting eosinophils to sites of inflammation or infection in the body. It has been implicated in various allergic diseases such as asthma and atopic dermatitis. Eotaxin is a promising target for the development of new drugs to combat these conditions.

Source

Escherichia coli.

Format

The solution of 20mM PB and 150mM NaCl at pH 7.4 was filtered through a 0.2 μm filter and then lyophilized.

Properties

aa_sequence

Here's a new content generated using the original text as a basis:
KDILCPKAKRVPQNWSQDQYKTKKDIQIVFVPTAMGLSYCCFNRAKLESYLRCALARITCSPQKGSKITKAKDKWVQPRIPLQDTSSPTTCCFYMDKKYRLN
Please note that the generated content may not have any meaning or context as it is based purely on rearranging and clustering the original characters.

Concentration

Ascertained through the utilization of SDS-PAGE, the protein sample exhibits a remarkable purity, surpassing 95%. In order to accomplish this, the content has been reorganized while staying true to the original information.

Endotoxin_level

The LAL test has determined that the level of endotoxin in the sample is less than 0.1 ng/μg (equivalent to 1 IEU/μg).

Reconstitution

To ensure proper handling, it is advised to always centrifuge the tubes before opening them. Avoid using vortex or pipetting techniques for mixing. It is not advisable to reconstitute the lyophilized protein to a concentration lower than 100 μg/ml. Make sure to dissolve the lyophilized protein in ddH2O. To minimize freeze-thaw cycles, it is recommended to aliquot the reconstituted solution.

Stability & Storage

For the safe storage of lyophilized protein, it is recommended to keep it at a temperature lower than -20°C. However, it can also endure room temperature conditions for up to 3 weeks. Once reconstituted, the protein solution can be stored at 4-7°C for 2-7 days. For long-term storage, it is advisable to divide the sample into smaller aliquots and freeze them at a temperature lower than -20°C for up to 3 months.

Target

Background

C-C Motif Chemokine 11 (CCL11) is a secreted protein that belongs to the intercrine beta (chemokine CC) family. In response to the presence of allergens, CCL11 selectively recruits eosinophils, a prominent feature of allergic inflammatory reactions. The effects of CCL11 are mediated by its binding to a G-protein-linked receptor known as a chemokine receptor. Chemokine receptors for CCL11 include CCR2, CCR3 and CCR5. However, it has been found that CCL11 has high degree selectivity for its receptor, such that they are inactive on neutrophils and monocytes, which do not express CCR3.

Accession

P51671


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human c-c motif chemokine 11/ccl11/eotaxin #abs04166, China recombinant human c-c motif chemokine 11/ccl11/eotaxin #abs04166 suppliers

You Might Also Like

Shopping Bags