Recombinant Human B-cell Maturation Protein/BCMA/TNFRSF17 (C-Fc) #abs04650

Here's an example of a highly similar content based on the original text:
The product code abs04650-10ug refers to a particular item that is available for purchase. This code is used to identify the product and distinguish it from other similar items in the same category. By using the code, customers can easily find the product they are looking for and place an order. It is important to ensure that the code is accurate and entered correctly to avoid any confusion or errors in the ordering process. Additionally, customers can consult with customer service representatives if they have any questions or concerns about the product or the ordering process.

1-2 Weeks

123

50ug of abs04650 is available for purchase. Please note that the following content is generated using a language model and may not be a direct representation of the original text.

1-2 Weeks

337

The product identifier "abs04650-500ug" refers to a particular item. To create a closely related piece of content, we can restate the original information in a different manner.
The code "abs04650-500ug" is used to identify a specific product. To generate content that is similar in nature, we may choose to express the same information in an alternative way.

1-2 Weeks

1681

One possible way to rearrange and generate a highly similar content from the original text is:
The product code abs04650-1mg is an important identifier of a specific substance that is available in a one-milligram format. This information might be useful for researchers, scientists, or laboratory technicians who are working on projects that require this substance as a component or a reference material. By knowing the product code, they can quickly find the right product and place an order for it without confusion or error. Additionally, the product code might contain other information, such as the supplier, the batch number, the expiry date, or the purity level, which can further inform the users about the quality and reliability of the substance. Therefore, the product code serves as a convenient and informative tool for communicating essential details about a product in a concise and standardized format.

1-2 Weeks

2328

，。

Our Mammalian expression system is capable of producing Recombinant Human B-cell Maturation Protein, which is encoded by the target gene Met1-Ala54 and carries a Fc tag at the C-terminus. Our production process ensures the highest quality and purity of this protein. Our technology allows us to deliver a highly similar product that meets the needs of researchers and scientists worldwide.

There are various alternative labels that can be used to refer to something or someone. For instance, when we wish to describe something that has already been named, we can use a different term to create a sense of variety. These concepts could include synonyms, nicknames, aliases, or pseudonyms, just to name a few. Essentially, these substitutions can be used to help us better understand the nuances of language and exhibit our creativity in regards to word choice. By embracing the use of alternate labels, we can expand our vocabulary and better articulate our thoughts.

Tumor necrosis factor receptor superfamily member 17; TNFRSF17; B-cell maturation protein; CD269

Source

Human Cells

Format

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Properties

aa_sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNADIEGRMDEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Concentration

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin_level

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Target

Background

B cell maturation protein (BCMA) is a type III membrane protein which belongs to the TNF receptor superfamily (TNFRSF17). BCMA contains one extracellular cysteine rich domain, as well as TACI. Human BCMA is a 184 amino acid (aa) protein consisting of a 54 aa extracellular domain, a 23 aa transmembrane domain, and a 107 aa intracellular domain. Mouse and human BCMA share 62% amino acid identity. BCMA is mainly expressed in immune organs and mature B cell lines. BCMA appears to be localized to the Golgi compartment. BCMA may play an important role in B cell development, function and regulation.

Accession

Q02223