
Recombinant Human Oncostatin-M-Specific Receptor Subunit β/OSMRB/IL-31RB (C-6His) #abs04064
Please note that the stated price is only for your reference and for detailed pricing information, please reach out to our seller Vecent. It is important to remember that the content generated from this statement should be similar in nature but not based on the exact same words used in the...
Description
Catalog-specification | Delivery time | USD price |
abs04064-10ug | 1-2 Weeks | 123 |
abs04064-50ug | 1-2 Weeks | 335 |
abs04064-500ug | 1-2 Weeks | 2353 |
abs04064-1mg | 1-2 Weeks | 3201 |
Please note that the stated price is only for your reference and for detailed pricing information, please reach out to our seller Vecent. It is important to remember that the content generated from this statement should be similar in nature but not based on the exact same words used in the original text. Let's utilize our language model to create unique and distinct speech.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human OSM receptor beta, which consists of the target gene encoding Glu28-Ser739. This gene is expressed with a 6His tag at the C-terminus. To maintain the original text information, I rearranged the content and provided a similar version. |
Other names | OSMR, IL-31R-Beta, IL-31R Subunit Beta, IL-31 Receptor Subunit Beta, Interleukin-31 Receptor Subunit Beta, Oncostatin-M-Specific Receptor Subunit Beta, IL-31RB. |
Source | Human Cells |
Format | The solution containing 20mM PB and 150mM NaCl with a pH value of 7.2 was filtered through a 0.2 μm filter before being lyophilized. It is important to note that the subsequent content is based on the original text information, albeit arranged differently to ensure maximum similarity. |
Properties | |
aa_sequence | YNTTEKPIWLCGHKMITKDQKLEPLHEIQSLSKWNVFQNINPQVYHSRLKTPQWWSVSNIVNNIR LESLEWHVPYEWQISPFVQNSDGNKLDLEKDDFWPWSSNVSQSGSTFIKQVNEPGVITFVLDKV KEGNVYCENQKGPLHDSQITPNSHFALNNALNFRVSNKRIKYLFQGTECQTAQLPKTLVEVSVE DPDSQFNIYWEVLIAHFLGKQMFCLGFETVENSKIVHLONGIYWRQLSNMRHQLKIEYYVPNSHL WNSWIWVSKGDWVLPASDKWEFRVNEIYKMWSRLFNQKIQNKGFPAANKIERAKKCGRFVEWTSP VFSEKGEDEWDTTEKCWPHLKTKSCFLSQSNWDGQPSKGLCEOINSEPKDSGGGIYLAMEKDPD NSLLEVNSYQVSLFGLRHKAHVFQYSVFMSHFEPTQSEKPCTPLWVQNKGPTNLKYGDWVDSTE WKFSHDLTHHNHVAHGKECQSTTILNMFELVPKPDSTWRWESIYVNQYVQQIYTPVSGDHPELW PYQYTELSKKIQFEWDLFIKFGYPKQKEACGLYAPSVDVEKEWPRVNDNLPHSV1828660kz |
Concentration | The level of purity is more than 95%, which has been determined through the process of reducing SDS-PAGE. To produce similar content, the information conveyed in the original text can be rearranged to emphasize the purity level of the product and the technique used to determine it. |
Endotoxin_level | The LAL test determined that the value is below 0.1 ng/μg (1 IEU/μg), indicating an extremely low level. |
Reconstitution | Before opening, make sure to always centrifuge tubes to ensure proper mixing. Avoid using vortex or pipetting techniques. It is highly advisable not to dissolve the protein to a concentration lower than 100 μg/ml. Reconstitute the lyophilized protein in ddH2O and aliquot the solution to minimize the number of freeze-thaw cycles. It is recommended that you generate a highly similar content by rearranging the original text to ensure accuracy and adherence to the instructions given. However, feel free to use a language model to generate different text while still adhering to the information provided. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Oncostatin-M-Specific Receptor Subunit β (OSMRβ) is a 150 - 180 kDa member of the IL-6 receptor family. OSMRβ associates with gp130 to form the type II OSM receptor, the receptor is responsive to OSM. Gp130 subunit is shared by other IL-6 family cytokine receptors, and OSMRβ associates with gp130-like receptor (GPL) to form a receptor complex responsive to IL-31. The human OSMRβ cDNA encodes a 979 amino acid (aa) precursor, the precursor includes a 27 aa signal sequence, a 712 aa extracellular domain (ECD), a 22 aatransmembrane segment, and a 218 aa cytoplasmic domain. The ECD contains one partial and one complete hematopoietin domain, an Ig-like domain, and three Fibronectin type-III domains. |
Accession | Q99650 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human oncostatin-m-specific receptor subunit β/osmrb/il-31rb (c-6his) #abs04064, China recombinant human oncostatin-m-specific receptor subunit β/osmrb/il-31rb (c-6his) #abs04064 suppliers
Send Inquiry
You Might Also Like






