
Recombinant Human IL-6 Receptor Subunit α/IL-6RA/CD126 (C-6His) #abs04066
Please note that the price mentioned above is only for your reference. For detailed pricing information, please contact our seller Vecent. It's important to clarify that we cannot offer you an exact price until more information is provided. Therefore, we highly suggest reaching out to our seller...
Description
Catalog-specification | Delivery time | USD price |
abs04066-10ug | 1-2 Weeks | 161 |
abs04066-50ug | 1-2 Weeks | 482 |
abs04066-500ug | 1-2 Weeks | 2353 |
abs04066-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, please contact our seller Vecent. It's important to clarify that we cannot offer you an exact price until more information is provided. Therefore, we highly suggest reaching out to our seller for personalized assistance. We apologize for any inconvenience this may cause and appreciate your understanding.
Overview | |
Description | Our Mammalian expression system is capable of producing Recombinant Human Interleukin-6 receptor alpha. The target gene, which encodes Leu20-Asp358, is expressed with a 6His tag at the C-terminus. Amino acid sequence analysis confirms high similarity between the expressed protein and the native form. |
Other names | CD126, also known as gp80 or the membrane glycoprotein 80, is the IL-6 receptor subunit alpha. It is an essential component of the IL-6 receptor. IL-6R subunit alpha, IL-6R-alpha, or IL-6R 1 are alternative names used to refer to CD126. |
Source | Human Cells |
Format | The solution of PBS, pH 7.4 was filtered through a 0.2 μm filter and then lyophilized to obtain a dried product. |
Properties | |
aa_sequence | GRRLLLR SVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLL LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRR SVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLLR |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test has shown that the level of endotoxins in the substance in question is less than 0.1 ng/μg, which equates to 1 IEU/μg. This means that the substance has a very low level of endotoxins and is safe for use. |
Reconstitution | Prior to opening, always ensure that tubes containing the protein have been properly centrifuged. Agitation through vortex or pipetting should be avoided at all costs. We recommend against diluting the protein to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. It is suggested to aliquot the dissolved solution to minimize the amount of times it undergoes freeze-thaw cycles. To recap, for the best results, handle the protein with care and follow these guidelines closely. |
Stability & Storage | The storage recommendations for lyophilized protein dictate that it should be kept at temperatures below -20°C. However, it is also stated that the protein remains stable when stored at room temperature for a span of 3 weeks. On the other hand, once reconstituted into a solution, the protein can be stored at temperatures ranging from 4-7°C for a period of 2-7 days. In addition, if the reconstituted protein is divided into smaller portions, referred to as aliquots, they can be stored at temperatures below -20°C for up to 3 months. It is important to note that these guidelines aim to maintain the stability and integrity of the protein during storage. |
Target | |
Background | Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. IL6Ra is a part of the receptor for interleukin 6 cytokine. IL6Ra binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitates an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis. Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. |
Accession | P08887 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human il-6 receptor subunit α/il-6ra/cd126 (c-6his) #abs04066, China recombinant human il-6 receptor subunit α/il-6ra/cd126 (c-6his) #abs04066 suppliers
Send Inquiry
You Might Also Like






