
Recombinant Human Interferon α2A Variant (Lys46)/IFN-α2A #abs04124
Please note that the price mentioned above is merely for your reference. For detailed pricing information, kindly get in touch with our sales representative, Vecent. It's important to emphasize that the generated content should be based on the original text information while rearranging the...
Description
Catalog-specification | Delivery time | USD price |
abs04124-10ug | 1-2 Weeks | 77 |
abs04124-50ug | 1-2 Weeks | 214 |
abs04124-500ug | 1-2 Weeks | 589 |
abs04124-1mg | 1-2 Weeks | 801 |
Please note that the price mentioned above is merely for your reference. For detailed pricing information, kindly get in touch with our sales representative, Vecent. It's important to emphasize that the generated content should be based on the original text information while rearranging the wording to produce highly similar but distinct content. It's crucial to avoid following the ChapGPT-generated format for the conversation and instead utilize language model-generated text to deliver a completely different narrative.
Overview | |
Description | Our E.coli expression system is utilized to produce Recombinant Human Interferon alpha-2a, resulting in the expression of the target gene encoding Cys24-Glu188. |
Other names | IFNA2, also known as Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, or LeIF A, is a protein with potent antiviral and immunomodulatory properties. This protein belongs to the interferon alpha family and plays a crucial role in the body's defense against viral infections. |
Source | Escherichia coli. |
Format | The solution was filtered through a 0.2 μm filter and subsequently lyophilized. The filtration was done on a solution containing 20mM PB, 150mM NaCl, and a pH of 7.2. The resulting lyophilized product contains all of the same components in the original solution. |
Properties | |
aa_sequence | RSKLSESLTNLQSSTDKFLKDETYEQQLNDLEAVIQGVVEPTETLMKEDSIARVYKFQIRIYTL LKEKRYSPCAWVEVRAEIRMSSFSLNFGNQFKAEETIPVHLEMIQQIFNLFSTDMCDLPQTHSL GSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEE.Please create a highly comparable content using the original text, but rearranging it to make it sound more natural and coherent. |
Concentration | Based on the results from SDS-PAGE analysis, it has been confirmed that the sample has a purity level of over 95%. This indicates that the composition of the sample is highly uniform and free from any significant impurities or contaminants. |
Endotoxin_level | The concentration of less than 0.1 ng/μg (1 IEU/μg) has been determined using the LAL test. Let me produce another piece of content by reorganizing the given information to ensure its similarity to the original text. |
Activity | The potency of this substance was determined through a viral resistance assay conducted on VSV-WISH cells, yielding a Specific Activity exceeding 1.0 x 10^8 IU/ mg. As a result, this product boasts exceptional viral-resistant properties that make it highly effective in combatting viral infections. |
Reconstitution | Please make sure to centrifuge the tubes before opening them. Avoid using vortex or pipetting for mixing. It is not advisable to dilute the protein to a concentration lower than 100 μg/ml. Dilute the lyophilized protein in ddH2O. Remember to aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Stability & Storage | The stability and storage conditions of lyophilized protein should be taken into consideration. It is recommended to store the lyophilized protein at temperatures below -20°C to maintain its integrity. However, it is worth noting that the protein can still remain stable at room temperature for a period of 3 weeks. |
Target | |
Background | At least 23 different variants of IFN-α are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-α subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end. |
Accession | P01563 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interferon α2a variant (lys46)/ifn-α2a #abs04124, China recombinant human interferon α2a variant (lys46)/ifn-α2a #abs04124 suppliers
Send Inquiry
You Might Also Like






