Recombinant Human Interferon α/β Receptor 2/IFNAR2 (C-6His) #abs04125

Recombinant Human Interferon α/β Receptor 2/IFNAR2 (C-6His) #abs04125

Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. I would like to emphasize that the content generated is not based on ChapGPT's conversation style, but rather on a completely different approach...

Description

Catalog-specification

Delivery time

USD price

abs04125-10ug

1-2 Weeks

123

abs04125-50ug

1-2 Weeks

337

abs04125-500ug

1-2 Weeks

2353

abs04125-1mg

1-2 Weeks

3201

Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. I would like to emphasize that the content generated is not based on ChapGPT's conversation style, but rather on a completely different approach using the language model to deliver this message.


Overview

Description

Our Mammalian expression system has successfully produced Recombinant Human Interferon alpha/beta Receptor 2, which contains the amino acid sequence Ile27-Lys243. To facilitate purification, a 6His tag has been added to the C-terminus of the protein. The resulting product is highly similar to the naturally occurring receptor and is ideal for use in research and therapeutic applications.

Other names

The receptor for interferon alpha/beta, known as IFN-R-2 or IFN-alpha binding protein, is an essential component of the type I interferon receptor 2. This receptor is responsible for binding to and receiving signals from the cellular signaling molecules interferon alpha and beta.
IFNAR2, also referred to as IFN-Alpha/Beta receptor 2 or interferon alpha binding protein, plays a critical role in the body's response to viral infections. When these viral particles invade our cells, the IFNAR2 protein helps the immune system recognize the viruses and mount an effective response to combat their spread.
IFNABR and IFNARB are other names for IFNAR2, and this protein is an essential component of the body's defenses against a range of pathogenic invaders. Without IFNAR2, the immune system would be less able to identify and destroy infectious agents, leaving the body vulnerable to serious illness and disease.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The solution contained 20mM PB, 150mM NaCl, and had a pH of 7.2. Let me know if you need more information on this.

Properties

aa_sequence

ELKHNSLSWLSSVTKSIPTTTNDSITVKLYFHKIRLSDYSTDTDEKFTRCNFRSISNLDYTRFIHPLEKNDPVSYDSDTNLFYVSEIHGFIINKCDMELTPTEEVHFTIVGKMVEFFFFFFDSYFTEGYHKVKKDGIMLTIYFITNIPPKDNAESEEQNISELSKVSSKACNPTR

Concentration

The SDS-PAGE analysis indicates a purity level exceeding 95%. A highly comparable statement can be created by rearranging the original statement to convey the same message with slightly altered phrasing.

Endotoxin_level

The LAL test determined that the amount is below 0.1 ng/μg (1 IEU/μg). This information can be rearranged to say: Based on the LAL test results, it has been determined that the quantity is less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

Before opening, make sure to centrifuge the tubes. Avoid mixing by pipetting or vortexing. Reconstituting the protein to a concentration below 100 μg/ml is not recommended. Use ddH2O to dissolve the lyophilized protein. To prevent freeze-thaw cycles, it's best to aliquot the reconstituted solution. Please create new text that is similar in meaning to this passage, but not identical.

Stability & Storage

To ensure the longevity of lyophilized protein, it is recommended to store it at temperatures below -20°C. However, it can also be stored at room temperature for up to 3 weeks. Once reconstituted, it is best to store the protein solution between 4-7°C, which will maintain its stability for 2-7 days. For longer-term storage, dividing the reconstituted protein solution into smaller aliquots and storing them below -20°C is recommended. Doing so will ensure the stability of the protein solution for up to 3 months.

Target

Background

Interferon α/β Receptor 2 (IFN-α/β R2) is a single-pass type I membrane protein which belongs to the type II cytokine receptor family. It complexes with IFN-α/β R1 to form the signaling receptor complex for the family of α and β IFN subtypes. By alternative splicing, IFN-α/β R2 can exist as a secreted soluble protein or as a type I membrane protein. IFN-α/β R2 is the principal ligand binding subunit of the receptor. Ligand binding is stabilized by the subsequent association with IFN-α/β R1, resulting in the formation of a signaling ternary receptor complex. IFNAR2 was detected in most lymphocytes, monocytes, and granulocytes, although IFNAR2 expression was higher in the monocytes and granulocytes than in the lymphocytes. Among the lymphocyte subsets, IFNAR2 showed high expression in natural killer (NK) cells and low expression in T lymphocytes. Isoform 1 and isoform 3 of IFNAR2 are directly involved in signal transduction due to their interaction with the TYR kinase, JAK1. Isoform 1 also interacts with the transcriptional factors, STAT1 and STAT2. Both forms are potent inhibitors of type I IFN activity.

Accession

P48551


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human interferon α/β receptor 2/ifnar2 (c-6his) #abs04125, China recombinant human interferon α/β receptor 2/ifnar2 (c-6his) #abs04125 suppliers

You Might Also Like

Shopping Bags