
Recombinant Human NT-proBNP His Tag
Experimental result diagram SDS PAGE The electrophoresis bands are Marker,1μg NT-prosBNP,1μg NT-proBNP Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Description
| SKU-Pack Size | Availability | Price |
| abs05027-50μg | 1-2 weeks | $349.00 |
| abs05027-1mg | In stock | $2540.00 |
| Overview | |
| Synonym | Brain natriuretic peptide, also known as BNP or natriuretic peptide B, is a type of natriuretic peptide that is secreted by the heart. It is produced as a precursor molecule, known as natriuretic peptide precursor B (NPPB), which is then cleaved to produce the active BNP molecule. Another type of natriuretic peptide, known as gamma-brain natriuretic peptide, has also been identified. Both BNP and gamma-brain natriuretic peptide play important roles in regulating blood pressure and fluid balance in the body. Natriuretic peptides B are a group of related peptides that includes BNP and other related molecules. These peptides are involved in a wide range of physiological processes, including regulation of blood pressure, electrolyte balance, and cardiac function. Natriuretic protein is another term sometimes used to refer to these peptides, highlighting their role in regulating fluid balance in the body. Together, these molecules play an important role in maintaining overall homeostasis and health. |
| Source | human |
| Molecular Weight | 9.2 kDa |
| Appearance | freeze-dried powder |
| Properties | |
| Amino Acid Sequence | N-His tag: HHHHHHHPLG Protein sequence (P16860, His27-Arg102): HHHHHHHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR Based on the original information, a highly similar content can be generated by rearranging the sequence as follows: HHHHHHHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
| Purity | >95% SDS-PAGE (Reduced and non-reduced states) |
| Endotoxin Level | <0.2 EU/µg(gel method) |
| Reconstitution | The centrifuged sample was mixed with a specific amount of ultra-pure water and dissolved to prepare a liquid with a concentration of no more than 1 mg/mL. This solution was then ready for use in subsequent experiments. |
| Storage Temp. | To ensure optimal usage, samples should be stored at low temperatures. If used within 2-4 weeks, refrigeration at 4°C is sufficient. For longer storage periods, samples can be stored at temperatures ranging from -20℃ to -80℃ for up to 12 months. It's essential to follow the recommended storage guidelines to prevent any degradation or changes in sample quality. |
| Target | |
| Background | NT-probNP is a protein that belongs to the Natriuretic Peptide family and has a molecular weight of 8.5kDa. It is also known as B-type Brain Natriuretic Peptide and has natriuretic, diuretic and vasodilator effects. This protein is mainly synthesized and secreted by ventricular muscle cells, and its secretion is stimulated by conditions such as high ventricular load, ventricular wall tension and other cardiac dysfunctions. The level of NT-probNP in the body is directly proportional to the intensity of these stimulus factors, making it a highly specific and sensitive clinical marker of heart failure. It is widely used in early heart failure screening and prognosis evaluation. Our product is made using recombinant human NT-probNP protein expressed by escherichia coli BL21(DE3). The protein has a N-terminal fusion of His-Tag composed of 6 histidines. After extensive purification, filtration sterilization and freeze-drying, the product is ready for use. Overall, NT-probNP is an indispensable tool for assessing ventricular function and detecting early signs of heart failure. Our product offers a reliable source of this important protein for clinical use. |
| Accession | P16860 |
Experimental result diagram

SDS PAGE
The electrophoresis bands are Marker,1μg NT-prosBNP,1μg NT-proBNP
Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Hot Tags: recombinant human nt-probnp his tag, China recombinant human nt-probnp his tag suppliers
Send Inquiry
You Might Also Like






