Recombinant Mouse Interleukin-7/IL-7 (C-6His) #abs04391

abs04391-10ug

1-2 Weeks

230

abs04391-50ug

1-2 Weeks

673

abs04391-500ug

1-2 Weeks

2353

abs04391-1mg

1-2 Weeks

3491

Description

Our Mammalian expression system produces Recombinant Mouse Interleukin-7, which is created by expressing the target gene that encodes Glu26-Ile154. A 6His tag is present at the C-terminus of the generated product. In short, we use advanced technology to produce a high-quality, 6His tagged Recombinant Mouse Interleukin-7.

Other names

Lymphopoietin -1, also known as IL-7 (interleukin-7), is a crucial protein that plays a vital role in the immune system. IL-7 is a growth factor which is essential for the development of T cells and B cells, the two main types of immune cells that help protect the body against diseases and infections. It also acts as a survival factor for these cells, helping to keep them alive and functioning properly.
IL-7 is produced by a variety of different cells, including stromal cells, epithelial cells, and fibroblasts. It is involved in a wide range of biological processes, including bone marrow development and lymphoid organ development. IL-7 is also known to stimulate the production of natural killer cells and dendritic cells, which are both important components of the immune system.
In addition to its role in the immune system, IL-7 has also been studied in the context of cancer. It has been shown to promote the growth of certain types of cancer cells, and researchers are exploring ways to block its activity as a potential cancer therapy.
Overall, IL-7 is a fascinating protein with a range of important functions in the body. Understanding its role in the immune system and beyond will be crucial for developing new treatments for a variety of diseases and conditions.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It originated from a PBS solution with a pH value of 7.4.

Properties

aa_sequence

QF LKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIV ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQDHHHHHH
Please keep in mind that the generated content may be completely different from the original text information.

Concentration

The percentage of similarity was found to be over 95% after conducting SDS-PAGE reduction. To produce a similar content, the original text information was rearranged while preserving its meaning.

Endotoxin_level

The LAL test indicates that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg).

Activity

When evaluating cell proliferation, the effectiveness can be assessed by measuring its impact on PHA-activated human peripheral blood lymphocytes (PBL). Typically, the dosage required to achieve 50% effectiveness (ED50) is approximately 0.12 ng/mL.

Reconstitution

Before opening, always make sure to centrifuge the tubes. Avoid mixing by using a vortex or pipetting. It is highly advised not to reconstitute the protein to a concentration below 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. It is recommended to divide the reconstituted solution into smaller portions to minimize the number of freeze-thaw cycles. To create a unique variation of the given information, try the following approach:
"Prior to unsealing the tubes, ensure proper centrifugation. Avoid mixing by utilizing vortex or pipetting techniques. It is strongly recommended not to dissolve the lyophilized protein to a concentration lower than 100 μg/ml. Use ddH2O to reconstitute the protein efficiently. To prevent damage, aliquot the solution into smaller portions and minimize unnecessary freeze-thaw cycles."

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all naïve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction.

Accession

P10168