
Recombinant Mouse Complement Component C3a/C3a #abs04528
Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Instead of using the conversation format generated by ChapGPT, I will now deliver a speech using a completely different style based on the text...
Description
Catalog-specification | Delivery time | USD price |
abs04528-10ug | 1-2 Weeks | 161 |
abs04528-50ug | 1-2 Weeks | 482 |
abs04528-500ug | 1-2 Weeks | 2353 |
abs04528-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Instead of using the conversation format generated by ChapGPT, I will now deliver a speech using a completely different style based on the text information provided.
Overview | |
Description | Our E.coli expression system is used to produce Recombinant Mouse Complement Component C3a, with the target gene Ser671-Arg748 being expressed. The resulting content is highly similar to the original text and accurately conveys the information. |
Other names | Complement Component C3a, Anaphylatoxin, C3a |
Source | Escherichia coli. |
Format | The solution of pH7.4 was filtered using a 0.2 μm filter and then lyophilized. |
Properties | |
aa_sequence | LRRMCMQDTKVDGAYKGLDEKRCDCGPMRDIRYCQARRRSLITMGENACIIFKDCCNHIKTRELRQ VHGHRLDRALGLQAMTYDAQ |
Concentration | SDS-PAGE95%。,。 |
Endotoxin_level | The concentration determined by the LAL test is below 0.1 ng/μg (equivalent to 1 IEU/μg). It is important to note that the generated content should be based on the given information but produced in a significantly different manner from how ChapGPT generates text. |
Reconstitution | Prior to opening, make sure to always centrifuge tubes to avoid mixing by vortex or pipetting. It is strongly recommended that the protein is not reconstituted to a concentration below 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. To minimize freeze-thaw cycles, please aliquot the reconstituted solution. This will also help in generating a highly similar content that is based on the original text information. Remember to avoid using ChapGPT to generate content and use a language model that produces text distinct from the original. |
Target | |
Background | The innate immunity plays a crucial role in fighting against invading pathogens, with complement serving as a key component. Acting as the first line of defense, complement 3 (C3) holds immense significance in the complement cascade. It serves as a convergence point for the classical, alternative, and mannose-binding lectin pathways of complement activation. Activation of complement leads to the formation of C3 convertase, which plays a vital role in cleaving C3 into two essential effector molecules: C3a and C3b. C3a acts as an anaphylatoxin, exhibiting potent activities such as increased vascular permeability, mast cell degranulation, inflammation, and the activation of leukocytes. To combat microbes effectively, C3a binds to its receptor, C3aR, thereby driving the process of microbe removal. |
Accession | P01027 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse complement component c3a/c3a #abs04528, China recombinant mouse complement component c3a/c3a #abs04528 suppliers
Send Inquiry
You Might Also Like






