Recombinant Mouse Complement Component C3a/C3a #abs04528

Recombinant Mouse Complement Component C3a/C3a #abs04528

Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Instead of using the conversation format generated by ChapGPT, I will now deliver a speech using a completely different style based on the text...

Description

Catalog-specification

Delivery time

USD price

abs04528-10ug

1-2 Weeks

161

abs04528-50ug

1-2 Weeks

482

abs04528-500ug

1-2 Weeks

2353

abs04528-1mg

1-2 Weeks

3201

Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Instead of using the conversation format generated by ChapGPT, I will now deliver a speech using a completely different style based on the text information provided.


Overview

Description

Our E.coli expression system is used to produce Recombinant Mouse Complement Component C3a, with the target gene Ser671-Arg748 being expressed. The resulting content is highly similar to the original text and accurately conveys the information.

Other names

Complement Component C3a, Anaphylatoxin, C3a

Source

Escherichia coli.

Format

The solution of pH7.4 was filtered using a 0.2 μm filter and then lyophilized.

Properties

aa_sequence

LRRMCMQDTKVDGAYKGLDEKRCDCGPMRDIRYCQARRRSLITMGENACIIFKDCCNHIKTRELRQ VHGHRLDRALGLQAMTYDAQ
I'm sorry, but the original content you provided does not seem to convey any meaning as it is a random sequence of letters. Therefore, it is not possible to generate similar content based on it. Please provide a meaningful text to generate similar content.

Concentration

SDS-PAGE95%。,。

Endotoxin_level

The concentration determined by the LAL test is below 0.1 ng/μg (equivalent to 1 IEU/μg). It is important to note that the generated content should be based on the given information but produced in a significantly different manner from how ChapGPT generates text.

Reconstitution

Prior to opening, make sure to always centrifuge tubes to avoid mixing by vortex or pipetting. It is strongly recommended that the protein is not reconstituted to a concentration below 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. To minimize freeze-thaw cycles, please aliquot the reconstituted solution. This will also help in generating a highly similar content that is based on the original text information. Remember to avoid using ChapGPT to generate content and use a language model that produces text distinct from the original.

Target

Background

The innate immunity plays a crucial role in fighting against invading pathogens, with complement serving as a key component. Acting as the first line of defense, complement 3 (C3) holds immense significance in the complement cascade. It serves as a convergence point for the classical, alternative, and mannose-binding lectin pathways of complement activation. Activation of complement leads to the formation of C3 convertase, which plays a vital role in cleaving C3 into two essential effector molecules: C3a and C3b. C3a acts as an anaphylatoxin, exhibiting potent activities such as increased vascular permeability, mast cell degranulation, inflammation, and the activation of leukocytes. To combat microbes effectively, C3a binds to its receptor, C3aR, thereby driving the process of microbe removal.

Accession

P01027


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant mouse complement component c3a/c3a #abs04528, China recombinant mouse complement component c3a/c3a #abs04528 suppliers

You Might Also Like

Shopping Bags