
Recombinant Human Interleukin-25/IL-25 (C-6His) #abs04069
Please note that the price mentioned above is for reference purposes only. For detailed pricing information, kindly get in touch with our sales representative, Vecent. Feel free to reach out to Vecent to discuss the specific pricing details. This product is for research use only, not for use in...
Description
Catalog-specification | Delivery time | USD price |
abs04069-10ug | 1-2 Weeks | 161 |
abs04069-50ug | 1-2 Weeks | 482 |
abs04069-500ug | 1-2 Weeks | 2353 |
abs04069-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is for reference purposes only. For detailed pricing information, kindly get in touch with our sales representative, Vecent. Feel free to reach out to Vecent to discuss the specific pricing details.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Interleukin-25. In this process, the target gene that codes for Tyr33-Gly177 is expressed with a 6His tag attached at the C-terminus. To maintain the accuracy, this rearranged content is based on the original information provided. |
Other names | IL-25, also known as interleukin-17E or IL-17E, is a cytokine that plays a crucial role in various biological processes. It is commonly referred to as IL25 or IL17E in scientific literature. With its diverse functions and mechanisms of action, IL-25 has garnered significant attention in the field of immunology and related research. By manipulating the given content, we can obtain different phrases such as IL-17E, Interleukin-25, IL17E, IL-25, IL-25, and Interleukin-17E. |
Source | Human Cells |
Format | The solution containing 20mM Tris, 150mM NaCl, and 1mM EDTA with a pH of 8.0 was filtered through a 0.2 μm filter and then lyophilized. |
Properties | |
aa_sequence | LDHQRLNRDRLEYWRPISASIARNSLPGDNSEDARCPESHRRPNPELPPVPVTSWRLLEESETQD KGSPCCPWSHPYELLYRRVYFTQNHYLSLGNERPDMHSGTQLSCVPHCPACLRCRAHLYCLGKHTGEGYP VRLRRECSLNHQSLEYSPWTQPVVPLEPAEGNRPHRASPCRPPARDGLNPlease note that the generated content is not a direct copy of the original text, but rather a reordering of the same information to create a new version of the text. |
Concentration | SDS-PAGE,95%。 |
Endotoxin_level | The LAL test determined that the amount of endotoxin present was less than 0.1 ng/μg (equivalent to 1 IEU/μg). |
Reconstitution | Ensure that the tubes are centrifuged prior to opening. Avoid mixing via vortex or pipetting techniques. It is strongly advised against reconstituting to a concentration lower than 100 μg/ml. Begin by dissolving the lyophilized protein in ddH2O. Remember to aliquot the reconstituted solution to minimize the occurrence of freeze-thaw cycles. |
Stability & Storage | The ideal storage condition for lyophilized protein is below -20°C. However, it can still remain stable at room temperature for a period of three weeks. Once reconstituted, the protein solution should be stored at a temperature range of 4-7°C. It can be kept in this condition for a period varying between two to seven days. If needed for longer-term storage, it is recommended to divide the reconstituted samples into smaller aliquots and store them below -20°C. These aliquots can maintain stability for up to three months. |
Target | |
Background | Interleukin 25 (IL-25) belongs to the Interleukin 17 (IL-17) family of proteins, which is comprised of six members (IL-17, IL-17B through IL-17F). These proteins are secreted and are structurally related by sharing a conserved cysteine-knot fold near the C-terminus, but have considerable sequence divergence at the N-terminus. With the exception of IL-17B, which exists as a non-covalently linked dimer, all IL-17 family members are disulfide-linked dimers. IL-17 family proteins are pro-inflammatory cytokines that induce local cytokine production and are involved in the regulation of immune functions. Human interleukin-17E (IL17E), also referred to as Interleukin-25 (IL25), is a distinct member of the IL17 cytokine family comprised of at least six members sharing a conserved cysteine-knot structure but divergent at the N-terminus. IL25 is a glycoprotein secreted as dimers by innate effector eosinophils and basophils, and present at very low levels in various peripheral tissues. IL25, together with IL17B, are ligands for the cytokine receptor IL17BR, and the cross-linking induces NF-κB activation and production of the proinflammatory chemokine IL-8, as well as ERK, JNK, and p38 activation. Overexpression of IL25 gene in transgenic mice suggested that this cytokine can regulate hematopoietic and immune functions, and additionally is identified as a proinflammatory cytokine favoring Th2-type immune responses possibly by enhancing the maintenance and functions of adaptive Th2 memory cells. |
Accession | Q9H293 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interleukin-25/il-25 (c-6his) #abs04069, China recombinant human interleukin-25/il-25 (c-6his) #abs04069 suppliers
Send Inquiry
You Might Also Like






