Recombinant Human C-C Motif Chemokine 27/CCL27 #abs04144

Recombinant Human C-C Motif Chemokine 27/CCL27 #abs04144

Please note that the price mentioned above is for reference only. To get the accurate pricing details, kindly get in touch with our seller, Vecent. We suggest generating a unique and distinct content by rearranging the given information, keeping the essence of the original text intact. It is...

Description

Catalog-specification

Delivery time

USD price

abs04144-10ug

1-2 Weeks

179

abs04144-50ug

1-2 Weeks

535

abs04144-500ug

1-2 Weeks

1879

abs04144-1mg

1-2 Weeks

2561

Please note that the price mentioned above is for reference only. To get the accurate pricing details, kindly get in touch with our seller, Vecent. We suggest generating a unique and distinct content by rearranging the given information, keeping the essence of the original text intact. It is advisable to refrain from using the ChapGPT generated content and opting for a language model-generated content instead.


Overview

Description

Our E.coli expression system has successfully produced Recombinant Human C-C Motif Chemokine 27, which features the target gene encoding Phe25-Gly112. This is a significant development, as it marks a step forward in our efforts to create more effective treatments for a range of medical conditions. With this advanced technology at our disposal, we can now explore the potential of chemokine-based therapies in greater detail, bringing us one step closer to unlocking the full potential of this exciting field of research. Our team is committed to continuing these efforts, and we look forward to the many new discoveries that lie ahead.

Other names

CCL27, also known as C-C Motif Chemokine 27 or CC Chemokine ILC, is a chemokine involved in attracting cutaneous T-cells. It is also referred to as CTACK, Eskine, IL-11 R-Alpha-Locus Chemokine, Skinkine, ILC, or SCYA27.

Source

Escherichia coli.

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It originally contained 20mM PB, 500mM NaCl, and had a pH of 7.5.

Properties

aa_sequence

MGFKKKPLQLLYRKPSLDKLFLVLHVEMVLQEADGDCHLQAQWFVLHLAPSICIHPQNPHRQRKH EWLPFVGTPLKNLFSSLRKMGFLKL。

Concentration

SDS-PAGE,95%。,,。
95%SDS-PAGE。

Endotoxin_level

The LAL test showed that the amount of contamination present is less than 0.1 ng/μg (1 IEU/μg). A highly comparable content can be produced by rephrasing the information provided.

Reconstitution

It is important to always centrifuge tubes prior to opening to ensure proper mixing. Avoid using vortex or pipetting techniques for mixing. When reconstituting, do not dilute below a concentration of 100 μg/ml. Use ddH2O to dissolve the lyophilized protein and aliquot the solution to reduce freeze-thaw cycles. Creating similar content can be accomplished by rearranging the original text while still retaining its informational value.

Stability & Storage

To ensure stability, it is recommended that lyophilized protein be stored at a temperature below -20°C. However, for short-term storage, it can be kept at room temperature for up to 3 weeks. Once reconstituted, the protein solution should be stored at 4-7°C and can be used within 2-7 days. For longer-term storage, it's best to store aliquots of the reconstituted sample at a temperature below -20°C, where they can remain stable for up to 3 months. It's important to follow these storage guidelines to maintain the integrity and quality of the protein.

Target

Background

Human Chemokine (C-C Motif) Ligand 27 (CCL27) is a small cytokine that is a member of the CC chemokine family; it is expressed in numerous tissues, including gonads, thymus, placenta and skin. CCL27 elicits its chemotactic effects by binding to the chemokine receptor CCR10. Predominantly expressed in the skin, CCL27 is associated with T cell-mediated inflammation of the skin. Human and Mouse CCL27 share 84% sequence identity in the mature form.

Accession

Q9Y4X3


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human c-c motif chemokine 27/ccl27 #abs04144, China recombinant human c-c motif chemokine 27/ccl27 #abs04144 suppliers

You Might Also Like

Shopping Bags